DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PAB1

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_174676.2 Gene:PAB1 / 840313 AraportID:AT1G34140 Length:407 Species:Arabidopsis thaliana


Alignment Length:191 Identity:81/191 - (42%)
Similarity:116/191 - (60%) Gaps:3/191 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIE 171
            |.....|.:::|||:.|||||.:.|.||.||.:|:|.||:|..|.|:|||||.|.|:.:...|..
plant    25 NRMSGRGNVFVKNLDESIDNKQLCDMFSAFGKVLSCKVARDASGVSKGYGFVQFYSDLSVYTACN 89

  Fly   172 KVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLML 236
            ..||.|..||.:||..|:.|  .:.:|:..|.|:|||||.|..|:..|:.:|..:|.|||..:|.
plant    90 FHNGTLIRNQHIHVCPFVSR--GQWDKSRVFTNVYVKNLVETATDADLKRLFGEFGEITSAVVMK 152

  Fly   237 DEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERK 297
            |.||:|||||||.:|..::|:.|:..::|..: |.|.|:|.||..|..|.:::..|.|..|
plant   153 DGEGKSRRFGFVNFEKAEAAVTAIEKMNGVVV-DEKELHVGRAQRKTNRTEDLKAKFELEK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 33/69 (48%)
RRM3_I_PABPs 202..282 CDD:240826 36/79 (46%)
PAB1NP_174676.2 RRM_SF <1..23 CDD:302621
RRM2_I_PABPs 29..105 CDD:240825 36/75 (48%)
ELAV_HUD_SF 30..296 CDD:273741 80/186 (43%)
RRM3_I_PABPs 118..197 CDD:240826 36/79 (46%)
RRM4_I_PABPs 222..299 CDD:240827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.