Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_973752.1 | Gene: | AT1G03457 / 839497 | AraportID: | AT1G03457 | Length: | 438 | Species: | Arabidopsis thaliana |
Alignment Length: | 320 | Identity: | 56/320 - (17%) |
---|---|---|---|
Similarity: | 99/320 - (30%) | Gaps: | 142/320 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNG--- 175
Fly 176 ----------------------------------------------------------------- 175
Fly 176 -MLCNNQKVHVV-------------------------KFIPRRD--------------------- 193
Fly 194 -------------------------REQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHK 233
Fly 234 LMLDE-EGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRK 292 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 20/138 (14%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 27/80 (34%) | ||
AT1G03457 | NP_973752.1 | RRM1_2_CELF1-6_like | 13..89 | CDD:240807 | |
PABP-1234 | <14..346 | CDD:130689 | 28/235 (12%) | ||
RRM1_2_CELF1-6_like | 110..185 | CDD:240807 | 18/74 (24%) | ||
RRM3_CELF1-6 | 341..413 | CDD:240808 | 25/72 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |