DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT1G03457

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_973752.1 Gene:AT1G03457 / 839497 AraportID:AT1G03457 Length:438 Species:Arabidopsis thaliana


Alignment Length:320 Identity:56/320 - (17%)
Similarity:99/320 - (30%) Gaps:142/320 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNG--- 175
            |:::..|.:::....|...||.:|.|.:..:.:.....|:|..|:.::|:|.|.||:|.:||   
plant   110 KLFVGMLPKNVSETEVQSLFSEYGTIKDLQILRGSLQTSKGCLFLKYESKEQAVAAMEALNGRHI 174

  Fly   176 ----------------------------------------------------------------- 175
                                                                             
plant   175 MEGANVPLIVKWADTEKERQARRLLKVQSHVSRLDPQNPSMFGALPMSYVPPYNGYGYHVPGTYG 239

  Fly   176 -MLCNNQKVHVV-------------------------KFIPRRD--------------------- 193
             ||...|..|..                         :..|||:                     
plant   240 YMLPPIQTQHAFHNVISPNQGNGRALQGTALTESVPPRLAPRRNFPTALGNYGYHGLQYPMAFPR 304

  Fly   194 -------------------------REQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHK 233
                                     ..|.:.....||::.|:..||.:|.|...|:|:|::.|.|
plant   305 GMIPPRLPLTTVSPGISNNGTSIPSSLQTEGPAGANLFIYNIPREFEDQELAATFQPFGKVLSAK 369

  Fly   234 LMLDE-EGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRK 292
            :.:|: .|.|:.|||::|::..:|..|:..::|.||...| |.|.......::||:...|
plant   370 VFVDKATGISKCFGFISYDSQAAAQNAINTMNGCQLSGKK-LKVQLKRDNGQQQQQQQSK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/138 (14%)
RRM3_I_PABPs 202..282 CDD:240826 27/80 (34%)
AT1G03457NP_973752.1 RRM1_2_CELF1-6_like 13..89 CDD:240807
PABP-1234 <14..346 CDD:130689 28/235 (12%)
RRM1_2_CELF1-6_like 110..185 CDD:240807 18/74 (24%)
RRM3_CELF1-6 341..413 CDD:240808 25/72 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.