DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT1G17640

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001319031.1 Gene:AT1G17640 / 838341 AraportID:AT1G17640 Length:369 Species:Arabidopsis thaliana


Alignment Length:225 Identity:65/225 - (28%)
Similarity:103/225 - (45%) Gaps:43/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GGGALASGSTGG------------SGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNV 144
            ||.|:   .|||            |...|||  ||:::..:......:...:.|..||.:::..:
plant    38 GGAAV---DTGGIQMKHSVDHRHSSSSMSSP--GKLFVGGVSWETTAETFANYFGKFGEVVDSVI 97

  Fly   145 AKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQE-KA-THFKNLY 206
            ..|. .||.||:|||.|.....|...:|:.:  :.:::||.:.:.:||.|::.: || :..:.::
plant    98 MTDRITGNPRGFGFVTFADSAVAEKVLEEDH--VIDDRKVDLKRTLPRGDKDTDIKAVSKTRKIF 160

  Fly   207 VKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENPQSA--LAAVIGLHGKQL 268
            |..|.....|..|:..|..||.|..|::|.|.. ||||.||||.::...|.  |.:...:|  :|
plant   161 VGGLPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVH--EL 223

  Fly   269 GDNKFLYVARALSKAERQQEINRKLEERKR 298
            ||              :|.||.|  .|.||
plant   224 GD--------------KQVEIKR--AEPKR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 16/70 (23%)
RRM3_I_PABPs 202..282 CDD:240826 25/82 (30%)
AT1G17640NP_001319031.1 RRM_SF 68..138 CDD:418427 16/71 (23%)
RRM_SF 158..236 CDD:418427 30/95 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.