DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and RBP45B

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_172630.1 Gene:RBP45B / 837708 AraportID:AT1G11650 Length:405 Species:Arabidopsis thaliana


Alignment Length:312 Identity:71/312 - (22%)
Similarity:120/312 - (38%) Gaps:70/312 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 YHQQQPALNHHTLAAAHHQQQLHHHAAAA-----------------GHLSH------VGGGHAAS 56
            |..|||   :....||....|:.:..|||                 |.|.:      :.|..|.:
plant    24 YGYQQP---YGIAGAAPPPPQMWNPQAAAPPSVQPTTADEIRTLWIGDLQYWMDENFLYGCFAHT 85

  Fly    57 NHLAAAAVLGRHGHNSL-GSGHTSTSSHSANVGV-----------------GVGGGALASGSTGG 103
            ..:.:|.|:.......: |.|....:||:|...|                 .:...:|:||..  
plant    86 GEMVSAKVIRNKQTGQVEGYGFIEFASHAAAERVLQTFNNAPIPSFPDQLFRLNWASLSSGDK-- 148

  Fly   104 SGGNSSPDSGKIYIKNLERSIDNKAVYDTF-SVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAA 166
              .:.|||. .|::.:|...:.:..:.:|| :.:.::....|..|. .|.::|||||.|..|...
plant   149 --RDDSPDY-TIFVGDLAADVTDYILLETFRASYPSVKGAKVVIDRVTGRTKGYGFVRFSDESEQ 210

  Fly   167 RAAIEKVNGMLCNNQKVHVVKFIPR------RDREQEKAT--------HFKNLYVKNLSEEFTEQ 217
            ..|:.::||:.|:.:.:.:.....:      ||..|..|.        :...::|..|....|:.
plant   211 IRAMTEMNGVPCSTRPMRIGPAASKKGVTGQRDSYQSSAAGVTTDNDPNNTTVFVGGLDASVTDD 275

  Fly   218 HLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLG 269
            ||:.:|..||.|...|:     ...:|.|||.:.....|..|:..|:|.|||
plant   276 HLKNVFSQYGEIVHVKI-----PAGKRCGFVQFSEKSCAEEALRMLNGVQLG 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 18/71 (25%)
RRM3_I_PABPs 202..282 CDD:240826 21/68 (31%)
RBP45BNP_172630.1 RRM1_SECp43_like 63..142 CDD:409780 12/78 (15%)
RRM2_SECp43_like 154..233 CDD:409781 19/79 (24%)
RRM_SF 260..331 CDD:418427 21/68 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.