DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and SR30

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_172386.3 Gene:SR30 / 837433 AraportID:AT1G09140 Length:268 Species:Arabidopsis thaliana


Alignment Length:214 Identity:49/214 - (22%)
Similarity:80/214 - (37%) Gaps:31/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCN 179
            ||:.||...|....|.|.|..:|.|::.::....  ...||.||.|:....|..||...:|...:
plant     9 IYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPP--RPPGYAFVEFEDPRDADDAIYGRDGYDFD 71

  Fly   180 NQKVHVV------KFIPRRDR-----EQEKATHFKNLY---VKNLSEEFTEQHLREMFEPYGRIT 230
            ..::.|.      :|.|..||     ...:|...::.|   |..|....:.|.|::.....|.:.
plant    72 GCRLRVEIAHGGRRFSPSVDRYSSSYSASRAPSRRSDYRVLVTGLPPSASWQDLKDHMRKAGDVC 136

  Fly   231 SHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFL--------YVARALSKAERQQ 287
            ..::..|.:|.|   |.|.|.|......|:..|...:. .|.|.        |.:|::|   |..
plant   137 FSEVFPDRKGMS---GVVDYSNYDDMKYAIRKLDATEF-RNAFSSAYIRVREYESRSVS---RSP 194

  Fly   288 EINRKLEERKRQKAGQIFY 306
            :.::....|.|.:.....|
plant   195 DDSKSYRSRSRSRGPSCSY 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 19/69 (28%)
RRM3_I_PABPs 202..282 CDD:240826 19/90 (21%)
SR30NP_172386.3 RRM <1..165 CDD:223796 39/160 (24%)
RRM1_SF2_plant_like 8..79 CDD:241043 20/71 (28%)
RRM2_SF2_plant_like 109..184 CDD:241046 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.