DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and RBP45A

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_568815.1 Gene:RBP45A / 835581 AraportID:AT5G54900 Length:387 Species:Arabidopsis thaliana


Alignment Length:358 Identity:77/358 - (21%)
Similarity:128/358 - (35%) Gaps:117/358 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QQLHHHAAAAGHLSHVGGGHAASNHL--------------AAAAVLGRHGHNSLGSGHTSTSSHS 84
            ||...:||.||.:.      :...||              .:||.||:|.: .:||.:..::|..
plant     2 QQPPSNAAGAGQIP------SGQQHLWMMMQQQQQQQQMQLSAAPLGQHQY-GIGSQNPGSASDV 59

  Fly    85 ANVGVG---------------VGGGALASGS------TGGSGG-------------------NSS 109
            .::.:|               ...|...|..      ||.|.|                   |.:
plant    60 KSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQSEGYGFIEFVSHSVAERVLQTYNGA 124

  Fly   110 P---------------DSGK-----------IYIKNLERSIDNKAVYDTF-SVFGNILNCNVAKD 147
            |               .:|:           |::.:|...:.:..:.||| :|:|::....|..|
plant   125 PMPSTEQTFRLNWAQAGAGEKRFQTEGPDHTIFVGDLAPEVTDYMLSDTFKNVYGSVKGAKVVLD 189

  Fly   148 E-DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHV-----VKFIPRR-------------D 193
            . .|.|:|||||.|..|.....|:.::||..|:.:.:.:     ...:|.:             |
plant   190 RTTGRSKGYGFVRFADENEQMRAMTEMNGQYCSTRPMRIGPAANKNALPMQPAMYQNTQGANAGD 254

  Fly   194 REQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALA 258
            .:....|    ::|..|....|:..|:.:|..:|.:...|:     ...:|.|||.|.|..||..
plant   255 NDPNNTT----IFVGGLDANVTDDELKSIFGQFGELLHVKI-----PPGKRCGFVQYANKASAEH 310

  Fly   259 AVIGLHGKQLGDNKF-LYVARALSKAERQQEIN 290
            |:..|:|.|||.... |...|:.:|...|.:.|
plant   311 ALSVLNGTQLGGQSIRLSWGRSPNKQSDQAQWN 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 22/71 (31%)
RRM3_I_PABPs 202..282 CDD:240826 23/80 (29%)
RBP45ANP_568815.1 RRM1_SECp43_like 61..138 CDD:409780 9/76 (12%)
RRM2_SECp43_like 153..232 CDD:409781 22/78 (28%)
RRM3_NGR1_NAM8_like 259..330 CDD:409782 23/79 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.