DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT5G52545

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001332099.1 Gene:AT5G52545 / 835331 AraportID:AT5G52545 Length:155 Species:Arabidopsis thaliana


Alignment Length:217 Identity:49/217 - (22%)
Similarity:80/217 - (36%) Gaps:82/217 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 TGG----SGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDED----------GN 151
            |||    .|.|      ::|:.||:..|:..::...||.:|.|::      ||          |.
plant     3 TGGFVDEKGEN------RLYVGNLDLRINEASLIKMFSPYGKIIS------EDFLWHTRGPKKGE 55

  Fly   152 SRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTE 216
            .|||.|:.:..:|.|..|.||::|.|...:.: ||:..                         :|
plant    56 PRGYAFIQYSLKEEAELAKEKMHGRLACGRPL-VVRLA-------------------------SE 94

  Fly   217 QHLREMFEPYGRITSH---KLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVAR 278
            :||.:        :||   |..|.|..|:|      :.|..|:        |:...|.|...:..
plant    95 KHLED--------SSHDHSKRSLPEGNRTR------FVNGSSS--------GQMSRDEKVTAIKN 137

  Fly   279 ALSKAERQQEINRKLEERKRQK 300
            .|...|..::     .:.|:||
plant   138 KLKALEEDEK-----RDPKKQK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 22/79 (28%)
RRM3_I_PABPs 202..282 CDD:240826 16/82 (20%)
AT5G52545NP_001332099.1 RRM_RBM18 14..93 CDD:409791 24/110 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.