DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and CP31B

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_199836.1 Gene:CP31B / 835090 AraportID:AT5G50250 Length:289 Species:Arabidopsis thaliana


Alignment Length:187 Identity:54/187 - (28%)
Similarity:89/187 - (47%) Gaps:9/187 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VGGGAL----ASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDED-G 150
            :||.::    :..|..|.|....|:..|:::.||...:|::|:...|...|.:....|..:.| .
plant    87 IGGTSVTVDESFESEDGVGFPEPPEEAKLFVGNLPYDVDSQALAMLFEQAGTVEISEVIYNRDTD 151

  Fly   151 NSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFK---NLYVKNLSE 212
            .|||:|||...:.|.|..|:||.|....|.:::.|.:..||..|.:.:...:.   .:||.||..
plant   152 QSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPRGSRPERQPRVYDAAFRIYVGNLPW 216

  Fly   213 EFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENPQSALAAVIGLHGKQL 268
            :.....|..:|..:|::...:::.|.| ||||.||||...|......|:..|.|:.|
plant   217 DVDSGRLERLFSEHGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAALDGQNL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 21/70 (30%)
RRM3_I_PABPs 202..282 CDD:240826 22/71 (31%)
CP31BNP_199836.1 RRM_SF 114..193 CDD:418427 24/78 (31%)
RRM2_NsCP33_like 208..283 CDD:410187 22/66 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.