DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT5G41690

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001332758.1 Gene:AT5G41690 / 834172 AraportID:AT5G41690 Length:567 Species:Arabidopsis thaliana


Alignment Length:223 Identity:53/223 - (23%)
Similarity:96/223 - (43%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCN 179
            :::.||........::|.|:..|.:::..:..:.:|...|||||.|.|.:..:.|:|..||...:
plant   187 LFVANLSPQTKISDIFDFFNCVGEVVSIRLMVNHEGKHVGYGFVEFASADETKKALENKNGEYLH 251

  Fly   180 NQK--VHVVKFIP-------------------RRDR----EQEKATHF--------KNLYVKNLS 211
            :.|  :.|.|..|                   ||:.    |.|....|        |.|:|.:||
plant   252 DHKIFIDVAKTAPYPPGPKYNLVEKLCYEDYLRRESLPIDEDETPPEFVEAVGVRKKTLFVAHLS 316

  Fly   212 EEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNK-FLY 275
            .:....|:...|:..|.:...:|:|:..|:.....||.:.:...|..|:...:|:.|.|.| ||.
plant   317 RKTEITHIINFFKDVGEVVHVRLILNHTGKHVGCAFVEFGSANEAKMALETKNGEYLNDCKIFLE 381

  Fly   276 VARALSKAERQQEINRKL--EERKRQKA 301
            ||:.:.....:..|:.|:  |:..|:::
plant   382 VAKMVPYPPPKYCIHHKVWYEDYLRRES 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 18/71 (25%)
RRM3_I_PABPs 202..282 CDD:240826 24/88 (27%)
AT5G41690NP_001332758.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.