DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4612 and Cstf2t

DIOPT Version :9

Sequence 1:	NP_001246493.1	Gene:	CG4612 / 37914	FlyBaseID:	FBgn0035016	Length:	307	Species:	Drosophila melanogaster
Sequence 2:	NP_112539.2	Gene:	Cstf2t / 83410	MGIID:	1932622	Length:	632	Species:	Mus musculus

Alignment Length:	99	Identity:	28/99 - (28%)
Similarity:	57/99 - (57%)	Gaps:	8/99 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   190 PRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENP 253
            |..||.      .::::|.|:..|.||:.|:::|...|.:.|.:|:.|.| |:.:.:||..|::.
Mouse     9 PAMDRS------LRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQ 67

  Fly   254 QSALAAVIGLHGKQLGDNKFLYVARALSKAERQQ 287
            ::||:|:..|:|::. ..:.|.|..|.|:..:::
Mouse    68 ETALSAMRNLNGREF-SGRALRVDNAASEKNKEE 100

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4612	NP_001246493.1	RRM2_I_PABPs	115..185	CDD:240825
CG4612	NP_001246493.1	RRM3_I_PABPs	202..282	CDD:240826	24/80 (30%)
Cstf2t	NP_112539.2	RRM	<16..>109	CDD:223796	25/86 (29%)
		RRM_CSTF2_CSTF2T	18..92	CDD:241115	23/74 (31%)
		CSTF2_hinge	113..191	CDD:291025
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	201..296
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	365..433
		8 X 5 AA tandem repeats of M-E-T-R-[AG]	428..466
		12 X 5 AA tandem repeats of G-[AT]-G-[MI]-Q	508..565
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	519..590
		CSTF_C	588..628	CDD:291002
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910