DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and CID13

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_197832.1 Gene:CID13 / 832515 AraportID:AT5G24440 Length:320 Species:Arabidopsis thaliana


Alignment Length:167 Identity:38/167 - (22%)
Similarity:74/167 - (44%) Gaps:16/167 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCN 179
            :|:.:::..:..:.:...|...|.:::|.:..|.....| :.|:.|...|.||:|:.| :|.:..
plant   139 VYVSDIDNQVTEEQLASLFLSCGQVVDCRMCGDYKSILR-FAFIEFTDAEGARSALRK-SGTMFG 201

  Fly   180 NQKVHVV-----------KFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHK 233
            :..:.|.           .|:|:...|.||..  |.:|..|:.:|.|:..|...|:.......|.
plant   202 SHPIRVFMSKTAIAPVNPSFLPQSKDELEKCG--KTVYCTNIDKEVTKMELENFFKTVCGEVHHL 264

  Fly   234 LMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGD 270
            .:|.:.....|..||.::..:||::| :...|..||:
plant   265 RLLGDFYHQTRIAFVEFKLAESAISA-LNCSGVVLGE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 14/69 (20%)
RRM3_I_PABPs 202..282 CDD:240826 18/69 (26%)
CID13NP_197832.1 PAM2 64..78 CDD:336618
RRM1_CID8_like 135..214 CDD:240905 15/76 (20%)
RRM2_CID8_like 230..311 CDD:240906 20/74 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.