DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT5G19350

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_197436.1 Gene:AT5G19350 / 832055 AraportID:AT5G19350 Length:425 Species:Arabidopsis thaliana


Alignment Length:312 Identity:66/312 - (21%)
Similarity:122/312 - (39%) Gaps:70/312 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ANYHQQQPALNHHTLAAAHHQQQLHH-HAAAAGHL------SHVGGGHAASNHLAAAAVLGRHGH 70
            |..|..||....:     ||.|.|.. .....|.|      :::....:.:..|.:..|:    .
plant     2 AMMHPPQPPQGSY-----HHPQTLEEVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVI----R 57

  Fly    71 NSL-----GSGHTSTSSHSANV-------GVGVGGGALA---SGSTGGSGG--NSSPDSGKIYIK 118
            |.:     |.|.....||:|..       |..:.|..|.   :.::.|||.  ::.||. .|::.
plant    58 NKITGQPEGYGFIEFISHAAAERTLQTYNGTQMPGTELTFRLNWASFGSGQKVDAGPDH-SIFVG 121

  Fly   119 NLERSIDNKAVYDTFSV-FGNILNCNVAKD-EDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQ 181
            :|...:.:..:.:||.| :.::....|..| ..|.|:|||||.|..|.....|:.::||:.|:.:
plant   122 DLAPDVTDYLLQETFRVHYSSVRGAKVVTDPSTGRSKGYGFVKFAEESERNRAMAEMNGLYCSTR 186

  Fly   182 KVHVVKFIPRRDREQEKATHFKNLY-----------------------------VKNLSEEFTEQ 217
            .:.:....|:::...::....|.:|                             |.||.:..||:
plant   187 PMRISAATPKKNVGVQQQYVTKAVYPVTVPSAVAAPVQAYVAPPESDVTCTTISVANLDQNVTEE 251

  Fly   218 HLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLG 269
            .|::.|...|.:...|:     ..::.:|:|.::...||..||..:.|:.:|
plant   252 ELKKAFSQLGEVIYVKI-----PATKGYGYVQFKTRPSAEEAVQRMQGQVIG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/71 (28%)
RRM3_I_PABPs 202..282 CDD:240826 19/97 (20%)
AT5G19350NP_197436.1 RRM1_SECp43_like 25..105 CDD:409780 13/83 (16%)
RRM2_SECp43_like 115..194 CDD:409781 21/79 (27%)
RRM_SF 237..306 CDD:418427 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.