DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PAB2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_195137.5 Gene:PAB2 / 829557 AraportID:AT4G34110 Length:629 Species:Arabidopsis thaliana


Alignment Length:191 Identity:92/191 - (48%)
Similarity:133/191 - (69%) Gaps:2/191 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGM 176
            :|.|:||||:.|||:||::||||.||||::|.||.|..|.|:|||||.:.:||:|:.||||:|||
plant   123 AGNIFIKNLDESIDHKALHDTFSSFGNIVSCKVAVDSSGQSKGYGFVQYANEESAQKAIEKLNGM 187

  Fly   177 LCNNQKVHVVKFIPRRDREQ-EKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEG 240
            |.|:::|:|..|:.|::|:. ...|.|.|:|||||:|..|:..|:..|..||:|||..:|.|.||
plant   188 LLNDKQVYVGPFLRRQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFGEYGKITSAVVMKDGEG 252

  Fly   241 RSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKA 301
            :|:.||||.:||...|..||..|:|.:. |:|..||.||..|:||:.|:..:.|:..::.|
plant   253 KSKGFGFVNFENADDAARAVESLNGHKF-DDKEWYVGRAQKKSERETELRVRYEQNLKEAA 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 42/69 (61%)
RRM3_I_PABPs 202..282 CDD:240826 38/79 (48%)
PAB2NP_195137.5 PABP-1234 37..612 CDD:130689 92/191 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 103 1.000 Domainoid score I2252
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100425
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.