DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and LIF2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001031566.1 Gene:LIF2 / 827998 AraportID:AT4G00830 Length:495 Species:Arabidopsis thaliana


Alignment Length:266 Identity:59/266 - (22%)
Similarity:99/266 - (37%) Gaps:90/266 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDED-GNSRGYGFVHFDSEEAARAAIEKV 173
            |...:::|..|.|.:..:.:.|.....|.|....:.||.| |:|:||.||.|.:::.|:.|||::
plant   113 PHGSEVFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEEL 177

  Fly   174 ------------------NGMLCNN---------------------QKVHVVK------------ 187
                              |.:...|                     :.:.::|            
plant   178 HSKEFKGKTIRCSLSETKNRLFIGNIPKNWTEDEFRKVIEDVGPGVENIELIKDPTNTTRNRGFA 242

  Fly   188 FI---------------------------------PRRDREQE-KATHFKNLYVKNLSEEFTEQH 218
            |:                                 |:...|.. .|...|.|||||:.|..:.:.
plant   243 FVLYYNNACADYSRQKMIDSNFKLEGNAPTVTWADPKSSPEHSAAAAQVKALYVKNIPENTSTEQ 307

  Fly   219 LREMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSK 282
            |:|:|:.:|.:|  |::... :|..|.||||.|....|||.||......:: :.:.|.|..|..:
plant   308 LKELFQRHGEVT--KIVTPPGKGGKRDFGFVHYAERSSALKAVKDTERYEV-NGQPLEVVLAKPQ 369

  Fly   283 AERQQE 288
            |||:.:
plant   370 AERKHD 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 22/109 (20%)
RRM3_I_PABPs 202..282 CDD:240826 28/80 (35%)
LIF2NP_001031566.1 hnRNP-R-Q 112..>430 CDD:273732 59/266 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.