Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001031566.1 | Gene: | LIF2 / 827998 | AraportID: | AT4G00830 | Length: | 495 | Species: | Arabidopsis thaliana |
Alignment Length: | 266 | Identity: | 59/266 - (22%) |
---|---|---|---|
Similarity: | 99/266 - (37%) | Gaps: | 90/266 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 110 PDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDED-GNSRGYGFVHFDSEEAARAAIEKV 173
Fly 174 ------------------NGMLCNN---------------------QKVHVVK------------ 187
Fly 188 FI---------------------------------PRRDREQE-KATHFKNLYVKNLSEEFTEQH 218
Fly 219 LREMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSK 282
Fly 283 AERQQE 288 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 22/109 (20%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 28/80 (35%) | ||
LIF2 | NP_001031566.1 | hnRNP-R-Q | 112..>430 | CDD:273732 | 59/266 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |