DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT4G14300

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001328758.1 Gene:AT4G14300 / 827071 AraportID:AT4G14300 Length:411 Species:Arabidopsis thaliana


Alignment Length:194 Identity:48/194 - (24%)
Similarity:90/194 - (46%) Gaps:31/194 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVN 174
            |.||:::..:....|...:.:.|:.:|.:....|.:|: .|..||:|||.|.........:::.:
plant     4 DQGKLFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQEKH 68

  Fly   175 GMLCNNQKVHVVKFIPRRDREQEKAT---------------HFKNLYVKNLSEEFTEQHLREMFE 224
            .:  :.::|.|.:.:.|.:::....|               ..|.::|..|....|::..|:.||
plant    69 SI--DTREVDVKRAMSREEQQVSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFE 131

  Fly   225 PYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAVI-----GLHGKQLGDNKFLYVARALSK 282
            .||.:|...:|.|: ..|.|.||||:::: :.|:.:|:     .|.|||      :.|.|||.|
plant   132 VYGPVTDVAIMYDQATNRPRGFGFVSFDS-EDAVDSVLHKTFHDLSGKQ------VEVKRALPK 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 13/70 (19%)
RRM3_I_PABPs 202..282 CDD:240826 28/85 (33%)
AT4G14300NP_001328758.1 RRM1_hnRNPA_hnRNPD_like 8..78 CDD:409763 13/71 (18%)
RRM2_Hrp1p 111..188 CDD:409767 27/83 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.