DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and CID10

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001030833.1 Gene:CID10 / 824101 AraportID:AT3G49390 Length:353 Species:Arabidopsis thaliana


Alignment Length:169 Identity:44/169 - (26%)
Similarity:81/169 - (47%) Gaps:23/169 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCN 179
            :|:.::::.:..:.:...|...|.:::|.|..|.:...| :.|:.|.:||.||||: .::|.:..
plant   171 VYVSDIDQQVTEENLAGVFINCGQVVDCRVCGDPNSVLR-FAFIEFTNEEGARAAL-SMSGTVLG 233

  Fly   180 NQKVHVV-----------KFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPY-GRITSH 232
            ...:.|:           .|:||.:.|:|...  :.:|..|:.:..|:..|:..||.. |.:  |
plant   234 FYPLKVLPSKTAIAPVNPTFLPRSEDEREMCV--RTVYCTNIDKRITQIDLKGFFEMLCGEV--H 294

  Fly   233 KLMLDEEGRSRRFGFVAYENPQSALAAVIGLH--GKQLG 269
            :|.|.:.....|..||.:...:||:||   ||  |..||
plant   295 RLRLGDYHHQTRIAFVEFAMAESAIAA---LHCSGIVLG 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 16/69 (23%)
RRM3_I_PABPs 202..282 CDD:240826 22/71 (31%)
CID10NP_001030833.1 RRM 68..287 CDD:223796 26/119 (22%)
RRM1_CID8_like 167..246 CDD:409892 17/76 (22%)
RRM2_CID8_like 262..342 CDD:409893 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.