DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT3G47120

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_190296.1 Gene:AT3G47120 / 823865 AraportID:AT3G47120 Length:352 Species:Arabidopsis thaliana


Alignment Length:131 Identity:39/131 - (29%)
Similarity:61/131 - (46%) Gaps:17/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 NNQKVHVVKFIPRRDRE----QEKATH--FKN---LYVKNLSEEFTEQHLREMFEPYGRITSHKL 234
            |.||::.      |:.:    .|.:.|  :||   :||..:..:.||..|..:|..||.|....|
plant     9 NLQKINA------RESDLGISDEASWHAKYKNSAYVYVGGIPFDLTEGDLLAVFSQYGEIVDVNL 67

  Fly   235 MLDE-EGRSRRFGFVAYENPQSALAAVIGLHGK-QLGDNKFLYVARALSKAERQQEINRKLEERK 297
            :.|: .|:|:.|.|:|||:.:|.:.||..|:|. .||....:....|..|.|.:.|..|:.....
plant    68 IRDKGTGKSKGFAFLAYEDQRSTILAVDNLNGALVLGRTIKVDHCGAYKKHEEEDEETRRQNREA 132

  Fly   298 R 298
            |
plant   133 R 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 3/5 (60%)
RRM3_I_PABPs 202..282 CDD:240826 28/84 (33%)
AT3G47120NP_190296.1 RRM <16..>110 CDD:223796 30/93 (32%)
RRM_ist3_like 27..115 CDD:240857 28/87 (32%)
ZnF_C3H1 135..156 CDD:214632
ZnF_C3H1 185..206 CDD:214632
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.