DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PAB6

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_188259.1 Gene:PAB6 / 820885 AraportID:AT3G16380 Length:537 Species:Arabidopsis thaliana


Alignment Length:288 Identity:94/288 - (32%)
Similarity:140/288 - (48%) Gaps:62/288 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LGRHGHNS-LGSGHTSTSS-----------HSANVGV--------GVGGGALA----------SG 99
            ||.|.|:| .||.:....|           .|.||.|        .|.|.::.          |.
plant    11 LGNHQHSSRFGSLYVGDLSPDVTEKDLIDKFSLNVPVVSVHLCRNSVTGKSMCYAYINFDSPFSA 75

  Fly   100 STGGSGGNSSPDSGK-----------------------IYIKNLERSIDNKAVYDTFSVFGNILN 141
            |...:..|.|...||                       :|:|||:.||.:..:...|..||:||:
plant    76 SNAMTRLNHSDLKGKAMRIMWSQRDLAYRRRTRTGFANLYVKNLDSSITSSCLERMFCPFGSILS 140

  Fly   142 CNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDRE----QEKATHF 202
            |.|. :|:|.|:|:|||.||:|::|.:|...::|.:...:|:.|.|||.:.:|.    .:.:|  
plant   141 CKVV-EENGQSKGFGFVQFDTEQSAVSARSALHGSMVYGKKLFVAKFINKDERAAMAGNQDST-- 202

  Fly   203 KNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQ 267
             |:|||||.|..|:..|..:|..||.::|..:|.|..||||.||||.:.||::|..|:..|.|.|
plant   203 -NVYVKNLIETVTDDCLHTLFSQYGTVSSVVVMRDGMGRSRGFGFVNFCNPENAKKAMESLCGLQ 266

  Fly   268 LGDNKFLYVARALSKAERQQEINRKLEE 295
            ||..| |:|.:||.|.||::.:.:|..:
plant   267 LGSKK-LFVGKALKKDERREMLKQKFSD 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 27/69 (39%)
RRM3_I_PABPs 202..282 CDD:240826 37/79 (47%)
PAB6NP_188259.1 PABP-1234 22..477 CDD:130689 88/277 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.