DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT3G14100

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_188026.1 Gene:AT3G14100 / 820626 AraportID:AT3G14100 Length:427 Species:Arabidopsis thaliana


Alignment Length:209 Identity:52/209 - (24%)
Similarity:98/209 - (46%) Gaps:30/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNILNCN-VAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLC 178
            :|:.|:...:....:.:.|:..|.:.:.. :.||:.    .|||||:....:|..||..:||...
plant    61 VYVGNIHTQVTEPLLQEIFTSTGPVESSKLIRKDKS----SYGFVHYFDRRSAALAILSLNGRHL 121

  Fly   179 NNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE-GRS 242
            ..|.:. |.:.....:.::.::|| |::|.:||.|.|:..|.:.|..:...:..::|.|:: |||
plant   122 FGQPIK-VNWAYATGQREDTSSHF-NIFVGDLSPEVTDATLYQSFSVFSSCSDARVMWDQKTGRS 184

  Fly   243 RRFGFVAYENPQSALAAVIGLHGKQL----------------GDNKFLYVARAL------SKAER 285
            |.||||::.|.|.|..|:..::||.|                ||:|.....:::      |..:.
plant   185 RGFGFVSFRNQQDAQTAINEMNGKWLSSRQIRCNWATKGATSGDDKLSSDGKSVVELTTGSSEDG 249

  Fly   286 QQEINRKLEERKRQ 299
            ::.:|.:..|...|
plant   250 KETLNEETPENNSQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/70 (24%)
RRM3_I_PABPs 202..282 CDD:240826 29/102 (28%)
AT3G14100NP_188026.1 RRM1_TIA1_like 61..131 CDD:240798 18/74 (24%)
ELAV_HUD_SF 70..323 CDD:273741 50/200 (25%)
RRM2_PUB1 145..219 CDD:241063 25/73 (34%)
RRM3_TIA1_like 265..340 CDD:240800
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.