DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT3G10845

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_683549.1 Gene:AT3G10845 / 820254 AraportID:AT3G10845 Length:423 Species:Arabidopsis thaliana


Alignment Length:187 Identity:44/187 - (23%)
Similarity:79/187 - (42%) Gaps:36/187 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKV-----HVVKFIPRR-----DREQEKAT---- 200
            |...|.|||.|.|.:.|..|:||..|....:.::     ::..|.|.:     .:|:::|.    
plant   220 GKHVGKGFVEFASAKEAENALEKKKGEYLQDGEIFLKAANIAPFPPPKYEDYLGQERDEAAVEGL 284

  Fly   201 ----HF------KNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQS 255
                :|      |.|:|.||....:.|.:...|:.: .:...:|::|:.|:....|:..:.:...
plant   285 AETPYFVEEARKKTLFVTNLPPRTSIQRMLYFFQDF-EVVRVRLIVDQSGKHMGCGYFEFASANE 348

  Fly   256 ALAAVIGLHGKQLGDNK-FLYVAR-ALSKAERQQEINRKL---------EERKRQKA 301
            |..|:...:||.|..:| ||.:|. |....:...::..||         ...|:|||
plant   349 AEKALEQRNGKSLRYHKIFLELAEIAPYPLQHMYKLAEKLWYEDNLLRESNLKQQKA 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 12/39 (31%)
RRM3_I_PABPs 202..282 CDD:240826 22/87 (25%)
AT3G10845NP_683549.1 RRM_SF 129..197 CDD:240668
RRM_SF <213..248 CDD:302621 12/27 (44%)
RRM_SF 299..369 CDD:240668 17/70 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.