DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT3G07810

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_850539.1 Gene:AT3G07810 / 819972 AraportID:AT3G07810 Length:495 Species:Arabidopsis thaliana


Alignment Length:204 Identity:52/204 - (25%)
Similarity:85/204 - (41%) Gaps:41/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAI-EKV 173
            |:||::|..:....:.:.:.:.||.||.::...:.||. .|.:||:|||.|.....|...| ||.
plant     4 DNGKLFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEIVITEKH 68

  Fly   174 NGMLCNNQKVHVVKFIPRRDREQEKATH-------------FKNLYVKNLSEEFTEQHLREMFEP 225
            |   .:.:.|...|.:||.|:.....::             .:.::|..|....||...:..||.
plant    69 N---IDGRLVEAKKAVPRDDQNMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQ 130

  Fly   226 YGRITSHKLMLDEE-GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEI 289
            :|..|...:|.|.. .|.|.|||:.|::.::                    |.:.|.|.  ..|:
plant   131 FGTTTDVVVMYDHNTQRPRGFGFITYDSEEA--------------------VEKVLLKT--FHEL 173

  Fly   290 NRKLEERKR 298
            |.|:.|.||
plant   174 NGKMVEVKR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/71 (28%)
RRM3_I_PABPs 202..282 CDD:240826 18/80 (23%)
AT3G07810NP_850539.1 RRM_SF 8..78 CDD:418427 20/72 (28%)
RRM <89..286 CDD:223796 25/116 (22%)
RRM2_Hrp1p 109..186 CDD:409767 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.