DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT2G47310

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_850472.1 Gene:AT2G47310 / 819344 AraportID:AT2G47310 Length:512 Species:Arabidopsis thaliana


Alignment Length:317 Identity:68/317 - (21%)
Similarity:113/317 - (35%) Gaps:52/317 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FRGNP---ANYHQQQPALNHHTLAAAHHQQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVLGRHG 69
            |.|.|   ..||.......||.:   |.....|||.||.|...:....:.....        ...
plant     9 FPGAPPPVPYYHNNYNNPPHHQI---HPPPPPHHHIAAVGFHKYPQNDNRDQRF--------NQP 62

  Fly    70 HNSLGSGHTSTSSHSANV-----GVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAV 129
            |.| |.........|.|.     ....||.:|....:..:..|:.....|:|:..:.::.....:
plant    63 HYS-GQQQNMIVDQSNNAPPPFPPSPCGGSSLRKRRSQSATDNADGSIAKLYVAPISKTATEYDI 126

  Fly   130 YDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVK------ 187
            ...|..:||:....:.||: .|....|.|:.:...|...|||..:........::..||      
plant   127 RQVFEKYGNVTEIILPKDKMTGERAAYCFIKYKKVEEGNAAIAALTEQFTFPGEMLPVKVRFAEA 191

  Fly   188 ------FIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFG 246
                  |.|.:..:..|      |||:.|:::.|:..:.|:|..||.|....:.||:....|.:.
plant   192 ERERIGFAPVQLPDNPK------LYVRCLNKQTTKMEVNEVFSRYGIIEDIYMALDDMKICRGYA 250

  Fly   247 FVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLEERKRQKAGQ 303
            ||.:...:.||||:..|:|        |:..|.     ..|.:..:..:.|:.:.|:
plant   251 FVQFSCKEMALAAIKALNG--------LFTIRG-----SDQPLIVRFADPKKPRLGE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 13/70 (19%)
RRM3_I_PABPs 202..282 CDD:240826 23/79 (29%)
AT2G47310NP_850472.1 RRM_SF 111..190 CDD:418427 16/78 (21%)
RRM_SF 208..287 CDD:418427 25/97 (26%)
WW 406..432 CDD:395320
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.