DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and ML2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_565990.1 Gene:ML2 / 818890 AraportID:AT2G42890 Length:843 Species:Arabidopsis thaliana


Alignment Length:193 Identity:45/193 - (23%)
Similarity:85/193 - (44%) Gaps:19/193 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIE 171
            |....|..::::|:..|:::..:...|..||.|.:...|    ..|||:..:.:....||.||:.
plant   192 NGEHPSRTLFVRNINSSVEDSELSALFEPFGEIRSLYTA----CKSRGFVMISYYDIRAAHAAMR 252

  Fly   172 KVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLML 236
            .:...|...:.:.:...|| ::...||..:...|.:.|:....:...|.::|..||.|...:   
plant   253 ALQNTLLRKRTLDIHFSIP-KENPSEKDMNQGTLVIFNVDTTVSNDELLQLFGAYGEIREIR--- 313

  Fly   237 DEEGRSRRF-GFVAYENPQSALAAVIGLHGKQLGDNKFLYV-------ARALSKAERQQEINR 291
              |..:||| .|:.|.:.:.|..|:..|:..::| .|.:.:       ||.||...:.|::.|
plant   314 --ETPNRRFHRFIEYYDVRDAETALKALNRSEIG-GKCIKLELSRPGGARRLSVPSQSQDLER 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 15/69 (22%)
RRM3_I_PABPs 202..282 CDD:240826 21/87 (24%)
ML2NP_565990.1 PABP-1234 <149..471 CDD:130689 45/193 (23%)
RRM1_MEI2_like 197..273 CDD:409944 18/80 (23%)
RRM2_MEI2_like 282..352 CDD:409948 18/75 (24%)
RRM_2 679..775 CDD:112856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.