DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT2G37220

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_181259.1 Gene:AT2G37220 / 818299 AraportID:AT2G37220 Length:289 Species:Arabidopsis thaliana


Alignment Length:198 Identity:53/198 - (26%)
Similarity:87/198 - (43%) Gaps:25/198 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            |:::.||..::|:..:...|...||:....|..|: .|.|||:|||...|.....||.::.||..
plant    92 KLFVGNLPFNVDSAQLAQLFESAGNVEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYE 156

  Fly   178 CNNQKVHVVKFIPRRDREQ----------------------EKATHFKNLYVKNLSEEFTEQHLR 220
            .:.:.:.|....|...||.                      ..|.....:||.|||....:..|.
plant   157 LDGRPLRVNAGPPPPKREDGFSRGPRSSFGSSGSGYGGGGGSGAGSGNRVYVGNLSWGVDDMALE 221

  Fly   221 EMFEPYGRITSHKLMLD-EEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAE 284
            .:|...|::...:::.| :.|||:.||||.|::.|....|:..|.|..| |.:.:.|:.|.::..
plant   222 SLFSEQGKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADL-DGRQIRVSEAEARPP 285

  Fly   285 RQQ 287
            |:|
plant   286 RRQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/70 (29%)
RRM3_I_PABPs 202..282 CDD:240826 25/80 (31%)
AT2G37220NP_181259.1 RRM_SF 92..170 CDD:418427 22/77 (29%)
RRM2_NsCP33_like 205..280 CDD:410187 24/75 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.