DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT2G35410

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_181084.1 Gene:AT2G35410 / 818107 AraportID:AT2G35410 Length:308 Species:Arabidopsis thaliana


Alignment Length:173 Identity:51/173 - (29%)
Similarity:86/173 - (49%) Gaps:25/173 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEK-----V 173
            |:::.||..|:....:.:.|...|.:.|..:.:.:||.:||:.||...|.|.|:|||:|     |
plant    96 KLFVFNLPWSMSVNDISELFGQCGTVNNVEIIRQKDGKNRGFAFVTMASGEEAQAAIDKFDTFQV 160

  Fly   174 NGMLCNNQKVHVVKFIPRRDREQEKA-----------THFKNLYVKNLSEEFTEQHLREMF--EP 225
            :|.:.:      |.|..|..:...|:           |..| |||.||:.:....||||:|  ..
plant   161 SGRIIS------VSFARRFKKPTPKSPNDLPSPAPGDTRHK-LYVSNLAWKARSTHLRELFTAAD 218

  Fly   226 YGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQL 268
            :..:::..:..|.||||..:|||::...:.|..|:..|:||::
plant   219 FNPVSARVVFADPEGRSSGYGFVSFATREEAENAITKLNGKEI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 21/74 (28%)
RRM3_I_PABPs 202..282 CDD:240826 24/69 (35%)
AT2G35410NP_181084.1 PABP-1234 97..>279 CDD:130689 50/172 (29%)
RRM_SF 97..168 CDD:409669 21/76 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.