DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and PAB4

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_179916.1 Gene:PAB4 / 816867 AraportID:AT2G23350 Length:662 Species:Arabidopsis thaliana


Alignment Length:196 Identity:88/196 - (44%)
Similarity:131/196 - (66%) Gaps:9/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SSPDS-------GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEA 165
            ||.||       |.:::|||::|:|||.:::.||..|.|::|.||.|..|.|||||||.||:|::
plant   122 SSRDSSARRSGVGNLFVKNLDKSVDNKTLHEAFSGCGTIVSCKVATDHMGQSRGYGFVQFDTEDS 186

  Fly   166 ARAAIEKVNGMLCNNQKVHVVKFIPRRDREQ-EKATHFKNLYVKNLSEEFTEQHLREMFEPYGRI 229
            |:.||||:||.:.|::::.|..|:.:.:||. .....|.|:|||||||..|:..|:..|..||.|
plant   187 AKNAIEKLNGKVLNDKQIFVGPFLRKEERESAADKMKFTNVYVKNLSEATTDDELKTTFGQYGSI 251

  Fly   230 TSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEINRKLE 294
            :|..:|.|.:|:||.||||.:|||:.|..||..|:||:. |:|..||.:|..|:||:.|::|:.|
plant   252 SSAVVMRDGDGKSRCFGFVNFENPEDAARAVEALNGKKF-DDKEWYVGKAQKKSERELELSRRYE 315

  Fly   295 E 295
            :
plant   316 Q 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 34/69 (49%)
RRM3_I_PABPs 202..282 CDD:240826 39/79 (49%)
PAB4NP_179916.1 PABP-1234 47..631 CDD:130689 88/196 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 1 1.000 - - FOG0000294
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100425
Panther 1 1.100 - - O PTHR24012
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.