DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and emb2444

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_179441.1 Gene:emb2444 / 816366 AraportID:AT2G18510 Length:363 Species:Arabidopsis thaliana


Alignment Length:207 Identity:55/207 - (26%)
Similarity:105/207 - (50%) Gaps:15/207 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 SANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE 148
            :..:..|||...|     |......:.|: .:|:..|:..:..:.:::.|...|.::|..|.||.
plant     2 TTRIAPGVGANLL-----GQHSAERNQDA-TVYVGGLDAQLSEELLWELFVQAGPVVNVYVPKDR 60

  Fly   149 DGN-SRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSE 212
            ..| .:.|||:.:.|||.|..||:.:|.:..:.:.:.|.|    ..::::......||::.||..
plant    61 VTNLHQNYGFIEYRSEEDADYAIKVLNMIKLHGKPIRVNK----ASQDKKSLDVGANLFIGNLDP 121

  Fly   213 EFTEQHLREMFEPYGRITSH-KLMLD-EEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFL- 274
            :..|:.|.:.|..:|.|.|: |:|.| :.|.||.|||::|::.:::.||:..:.|:.|.:.:.. 
plant   122 DVDEKLLYDTFSAFGVIASNPKIMRDPDTGNSRGFGFISYDSFEASDAAIESMTGQYLSNRQITV 186

  Fly   275 -YVARALSKAER 285
             |..:..:|.||
plant   187 SYAYKKDTKGER 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 19/70 (27%)
RRM3_I_PABPs 202..282 CDD:240826 25/83 (30%)
emb2444NP_179441.1 RRM1_SF3B4 27..100 CDD:409771 20/72 (28%)
RRM2_SF3B4 111..193 CDD:409772 25/81 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.