DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and AT2G16940

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001189538.1 Gene:AT2G16940 / 816197 AraportID:AT2G16940 Length:610 Species:Arabidopsis thaliana


Alignment Length:213 Identity:50/213 - (23%)
Similarity:85/213 - (39%) Gaps:41/213 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVN 174
            |...::...:......:.||:.||..|.:.:..:..|. ...|||.|:|.|....:...|| .::
plant   229 DQRTVFAYQIALRATERDVYEFFSRAGKVRDVRIIMDRISRRSRGIGYVEFYDTMSVPMAI-ALS 292

  Fly   175 GMLCNNQKVHVVKFIPRRDREQEK-------------------ATHFKNLYVKNLSEEFTEQHLR 220
            |.....|.|.|      :..|.||                   :...:.|||.||....:|..||
plant   293 GQPLLGQPVMV------KPSEAEKNLVQSTTAAAGAGGMLGPYSGGARRLYVGNLHINMSEDDLR 351

  Fly   221 EMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAER 285
            ::||.:|.:...::..||.|..:.||||.:...:.|..| :.|:|:             |..|.|
plant   352 KVFESFGSVELVQVPRDETGLCKGFGFVQFARLEDARNA-LNLNGQ-------------LEIAGR 402

  Fly   286 QQEINRKLEERKRQKAGQ 303
            ..:::...::.:..:|||
plant   403 AIKVSAVTDQTEVPEAGQ 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/70 (24%)
RRM3_I_PABPs 202..282 CDD:240826 23/79 (29%)
AT2G16940NP_001189538.1 SF-CC1 30..607 CDD:273721 50/213 (23%)
RRM1_RBM39_like 232..304 CDD:240729 18/78 (23%)
RRM2_RBM23_RBM39 336..407 CDD:240730 25/84 (30%)
RBM39linker 436..531 CDD:292157
RRM3_RBM39_like 513..596 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.