DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Hnrnpd

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_077380.2 Gene:Hnrnpd / 79256 RGDID:620365 Length:353 Species:Rattus norvegicus


Alignment Length:284 Identity:72/284 - (25%)
Similarity:125/284 - (44%) Gaps:58/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GGGHAASNHLAAAAVLGRHGHNSLGSGHTSTSSHSANVGVGVGGGALASGSTGGS---------- 104
            ||..||:   ||.|.:|.......|:...:....:|..|.|.|||:...|:.|||          
  Rat     7 GGDGAAA---AATAAVGGSAGEQEGAMVAAAQGAAAAAGSGSGGGSAPGGTEGGSTEAEGAKIDA 68

  Fly   105 --------GGNSSP----------DSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DG 150
                    ..||||          :..|::|..|......|.:.|.||.||::::|.:..|. .|
  Rat    69 SKNEEDEGHSNSSPRHTEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGDVVDCTLKLDPITG 133

  Fly   151 NSRGYGFVHFDSEEAARAAIE----KVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLS 211
            .|||:|||.|...|:....::    |:||.:.:          |:|.:..:.....|.::|..||
  Rat   134 RSRGFGFVLFKESESVDKVMDQKEHKLNGKVID----------PKRAKAMKTKEPVKKIFVGGLS 188

  Fly   212 EEFTEQHLREMFEPYGRITSHKLMLDEEGRSRR-FGFVAYENPQSALAAVIGLHGKQLGDNKFLY 275
            .:..|:.:||.|..:|.:.|.:|.:|.:...|| |.|:.::..:..         |::.:.|:..
  Rat   189 PDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPV---------KKIMEKKYHN 244

  Fly   276 VARALSKAERQQEINRKLEERKRQ 299
            |  .|||.|.:..::::..::::|
  Rat   245 V--GLSKCEIKVAMSKEQYQQQQQ 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 22/74 (30%)
RRM3_I_PABPs 202..282 CDD:240826 20/80 (25%)
HnrnpdNP_077380.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 23/84 (27%)
CBFNT <55..76 CDD:285369 3/20 (15%)
RRM1_hnRNPD_like 97..170 CDD:241019 23/82 (28%)
RRM2_hnRNPD 181..255 CDD:241027 22/84 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.