DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and celf4

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_031757481.1 Gene:celf4 / 779831 XenbaseID:XB-GENE-5873699 Length:488 Species:Xenopus tropicalis


Alignment Length:257 Identity:68/257 - (26%)
Similarity:107/257 - (41%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 AAAVLGRHGHNSLGS---GHTSTSSHSANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLER 122
            |....|:..::||.|   ||.:..:||.      ||.|...        ....|:.|::|..:.|
 Frog     6 ATVANGQPDNSSLSSNPTGHMNGLTHSP------GGAATIP--------MKDHDAIKLFIGQIPR 56

  Fly   123 SIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVV 186
            ::|.|.:...|..||.|....|.||. .|..:|..|:.:...|:|..|          ...:|..
 Frog    57 NLDEKDLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKA----------QSALHEQ 111

  Fly   187 KFIPRRDR-------EQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRR 244
            |.:|..:|       :.|.....:.|:|..|:::.:|..:|.:||.:|.|....::...:|.|:.
 Frog   112 KTLPGMNRPIQVKPADSESRGEDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPDGNSKG 176

  Fly   245 FGFVAYENPQSALAAVIGLHGKQL--GDNKFLYVARALSKAERQQEINRKLEERKRQKAGQI 304
            ..||.|.:...|.||:..|||.|.  |.:..|.|..|.:..||..       .|.:|.|||:
 Frog   177 CAFVKYSSHAEAQAAINALHGSQTMPGASSSLVVKFADTDKERTM-------RRMQQMAGQM 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/70 (24%)
RRM3_I_PABPs 202..282 CDD:240826 25/81 (31%)
celf4XP_031757481.1 RRM1_CELF3_4_5_6 42..128 CDD:410041 23/95 (24%)
RRM2_CELF3_4_5_6 134..214 CDD:410043 24/79 (30%)
RRM3_CELF3_4_5_6 399..477 CDD:241083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.