DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Celf6

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:XP_006511603.1 Gene:Celf6 / 76183 MGIID:1923433 Length:481 Species:Mus musculus


Alignment Length:238 Identity:62/238 - (26%)
Similarity:107/238 - (44%) Gaps:38/238 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GGGALASG-------STGGSGG-----NSSP-------DSGKIYIKNLERSIDNKAVYDTFSVFG 137
            ||.|..:|       ||..|||     |..|       |:.|:::..:.|.:|.:.:...|..||
Mouse     6 GGSAPPAGPSPRLAFSTADSGGGMSGLNPGPAVPMKDHDAIKLFVGQIPRGLDEQDLKPLFEEFG 70

  Fly   138 NILNCNVAKDE-DGNSRGYGFVHF---DSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEK 198
            .|....|.||. .|..:|..|:.:   ||...|::|:.:...:...|:.:.|      :....|.
Mouse    71 RIYELTVLKDRLTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQV------KPAASEG 129

  Fly   199 ATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGL 263
            ....:.|:|..|.::..|:.:|.:|:|:|.|....::...:|.|:...||.:.:...|.||:.||
Mouse   130 RGEDRKLFVGMLGKQQGEEDVRRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIQGL 194

  Fly   264 HGKQ--LGDNKFLYVARALSKAERQQEINRKLEERKRQKAGQI 304
            ||.:  .|.:..|.|  .|:..:|::.:     .|.:|.|||:
Mouse   195 HGSRTMTGASSSLVV--KLADTDRERAL-----RRMQQMAGQL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/73 (23%)
RRM3_I_PABPs 202..282 CDD:240826 24/81 (30%)
Celf6XP_006511603.1 RRM1_CELF3_4_5_6 41..127 CDD:241076 20/91 (22%)
PABP-1234 <48..390 CDD:130689 49/196 (25%)
RRM2_CELF3_4_5_6 133..213 CDD:241079 24/81 (30%)
RRM3_CELF3_4_5_6 392..470 CDD:241083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.