DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Rbm31y

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_083246.1 Gene:Rbm31y / 74484 MGIID:1921734 Length:565 Species:Mus musculus


Alignment Length:193 Identity:52/193 - (26%)
Similarity:97/193 - (50%) Gaps:22/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 DSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDED-GNSRGYGFVHF-DSEEAARAAIEKV 173
            |:.|::|..|.:.:..:.:.:..|.||.|::..:..|.: |.|||:|||.| ||     |.:|||
Mouse    31 DASKMFIGGLSQEMSKQVLLEYLSKFGEIIDFIIKTDPNTGLSRGFGFVLFKDS-----ATVEKV 90

  Fly   174 NGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE 238
              :...:.||...|...:|.:..|.....|.::|..|:...:|:.:|..|..:|:|.:.:|.|..
Mouse    91 --LQVKDHKVDGKKIEFKRAKALESQFPNKKIFVGGLNPRLSEEKIRAYFGTFGQIEAIELPLCS 153

  Fly   239 EGRSRR-FGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARA---LSKAERQQEINRKLEERK 297
            :.|.|| |||:.|.:..|.         :::.:|::.::..:   :..|..::...|:|.:||
Mouse   154 DTRERRAFGFIKYMDENSV---------RKVLENRYHFIGSSRCEVKMAYPKENPARQLSKRK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 23/71 (32%)
RRM3_I_PABPs 202..282 CDD:240826 19/83 (23%)
Rbm31yNP_083246.1 RRM_SF 35..108 CDD:302621 24/79 (30%)
RRM_SF 119..193 CDD:302621 18/82 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.