DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and TIA1

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_071505.2 Gene:TIA1 / 7072 HGNCID:11802 Length:386 Species:Homo sapiens


Alignment Length:167 Identity:49/167 - (29%)
Similarity:80/167 - (47%) Gaps:14/167 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCN 179
            :|:.||.|.:....:...||..|...||.:..|..||. .|.||.|.....|.||:..:||....
Human     9 LYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGND-PYCFVEFHEHRHAAAALAAMNGRKIM 72

  Fly   180 NQKVHV----VKFIPRRDRE-------QEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHK 233
            .::|.|    .....::|..       |....|| :::|.:||.|.|.:.::..|.|:|||:..:
Human    73 GKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHF-HVFVGDLSPEITTEDIKAAFAPFGRISDAR 136

  Fly   234 LMLD-EEGRSRRFGFVAYENPQSALAAVIGLHGKQLG 269
            ::.| ..|:|:.:|||::.|...|..|:..:.|:.||
Human   137 VVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLG 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 22/69 (32%)
RRM3_I_PABPs 202..282 CDD:240826 23/69 (33%)
TIA1NP_071505.2 RRM1_TIA1 8..81 CDD:410027 23/72 (32%)
RRM2_TIA1 104..181 CDD:410030 24/71 (34%)
RRM3_TIAR 214..286 CDD:241064
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 354..386
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.