Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001103836.1 | Gene: | Pabpc5 / 688518 | RGDID: | 1587661 | Length: | 382 | Species: | Rattus norvegicus |
Alignment Length: | 202 | Identity: | 88/202 - (43%) |
---|---|---|---|
Similarity: | 127/202 - (62%) | Gaps: | 15/202 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 108 SSPDS-------GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEA 165
Fly 166 ARAAIEKVNGMLCNNQKVHVVKF-IPRRD----REQEKATHFKNLYVKNLSEEFTEQHLREMFEP 225
Fly 226 YGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEIN 290
Fly 291 RKLEERK 297 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 38/69 (55%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 33/79 (42%) | ||
Pabpc5 | NP_001103836.1 | RRM1_I_PABPs | 22..98 | CDD:240824 | 2/3 (67%) |
ELAV_HUD_SF | 29..271 | CDD:273741 | 78/179 (44%) | ||
RRM2_I_PABPs | 104..179 | CDD:240825 | 40/75 (53%) | ||
RRM3_I_PABPs | 198..277 | CDD:240826 | 33/79 (42%) | ||
RRM_SF | 301..377 | CDD:302621 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG52254 | |
OrthoDB | 1 | 1.010 | - | - | D1027234at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24012 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.120 |