DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Pabpc5

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001103836.1 Gene:Pabpc5 / 688518 RGDID:1587661 Length:382 Species:Rattus norvegicus


Alignment Length:202 Identity:88/202 - (43%)
Similarity:127/202 - (62%) Gaps:15/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 SSPDS-------GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEA 165
            |.||.       |.|:||||::||||:|::..||.|||||:|.|..|::| |:||.:|||||..|
  Rat    94 SQPDDHLRKSGVGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVVCDDNG-SKGYAYVHFDSLAA 157

  Fly   166 ARAAIEKVNGMLCNNQKVHVVKF-IPRRD----REQEKATHFKNLYVKNLSEEFTEQHLREMFEP 225
            |..||..:||:..||::|:|.:| .|...    |.:::|| |.|::|||..::..::.|:::|..
  Rat   158 ANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRAT-FTNVFVKNFGDDIDDEKLKKLFSE 221

  Fly   226 YGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAERQQEIN 290
            ||...|.|::.|..|:|:.||||.||..::|..||:.||||.: |.|.|.|.||..|.||..|:.
  Rat   222 YGPTESVKVIRDATGKSKGFGFVRYETHEAAQKAVLELHGKSI-DGKVLCVGRAQKKIERLAELR 285

  Fly   291 RKLEERK 297
            |:.|..|
  Rat   286 RRFERLK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 38/69 (55%)
RRM3_I_PABPs 202..282 CDD:240826 33/79 (42%)
Pabpc5NP_001103836.1 RRM1_I_PABPs 22..98 CDD:240824 2/3 (67%)
ELAV_HUD_SF 29..271 CDD:273741 78/179 (44%)
RRM2_I_PABPs 104..179 CDD:240825 40/75 (53%)
RRM3_I_PABPs 198..277 CDD:240826 33/79 (42%)
RRM_SF 301..377 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52254
OrthoDB 1 1.010 - - D1027234at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24012
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.120

Return to query results.
Submit another query.