DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and CELF5

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_068757.2 Gene:CELF5 / 60680 HGNCID:14058 Length:485 Species:Homo sapiens


Alignment Length:223 Identity:54/223 - (24%)
Similarity:94/223 - (42%) Gaps:34/223 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GSTGGSGGNSSP------DSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYG 156
            ||:|.......|      |:.|:::..:.|.:|.|.:...|..||.|....|.||. .|..:|..
Human    25 GSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCA 89

  Fly   157 FVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDR--------EQEKATHFKNLYVKNLSEE 213
            |:.:.:.::|..|          ...:|..|.:|...|        .:.:....:.|:|..|:::
Human    90 FLTYCARDSAIKA----------QTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQ 144

  Fly   214 FTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQL--GDNKFLYV 276
            .:|:.:..:|:|:|.|....::...:|.|:...||.:.:...|.||:..|||.|.  |.:..|.|
Human   145 QSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVV 209

  Fly   277 ARALSKAERQQEINRKLEERKRQKAGQI 304
            ..|.:..||..       .|.:|..||:
Human   210 KFADTDKERTL-------RRMQQMVGQL 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 15/70 (21%)
RRM3_I_PABPs 202..282 CDD:240826 23/81 (28%)
CELF5NP_068757.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 4/14 (29%)
RRM1_CELF3_4_5_6 40..126 CDD:410041 21/95 (22%)
half-pint 46..>372 CDD:130706 49/202 (24%)
RRM2_CELF3_4_5_6 133..213 CDD:410043 22/79 (28%)
RRM3_CELF3_4_5_6 396..474 CDD:241083
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.