DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and hnrnpd

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001025523.1 Gene:hnrnpd / 594903 XenbaseID:XB-GENE-988375 Length:295 Species:Xenopus tropicalis


Alignment Length:228 Identity:58/228 - (25%)
Similarity:101/228 - (44%) Gaps:43/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TSSHSANVGVGVGGGALASGSTGGSGGNSSPDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNV 144
            |.....|.||.:            ....:..|.||::|..|......|.:.|.||.||.:::|.:
 Frog    17 TEETGQNEGVKI------------DASKTEEDEGKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTL 69

  Fly   145 AKDE-DGNSRGYGFVHFDSEEAARAAIE----KVNGMLCNNQKVHVVKFIPRRDREQEKATHFKN 204
            ..|. .|.|||:|||.|...|.....:|    |:||.:.:          |:|.:..:.....|.
 Frog    70 KLDPITGRSRGFGFVLFKESEGVDKVMEQKEHKLNGKVID----------PKRAKAMKTKEPVKK 124

  Fly   205 LYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRR-FGFVAY--ENPQSALAAVIGLHGK 266
            ::|..||.:..|:.:||.|..:|.|.:.:|.:|.:...|| |.|:.:  |:|.           |
 Frog   125 IFVGGLSPDTPEEKIREYFGTFGEIEAIELPMDNKTNKRRGFCFITFKEEDPV-----------K 178

  Fly   267 QLGDNKFLYVARALSKAERQQEINRKLEERKRQ 299
            ::.:.|:..|  .|||.|.:..::::..::::|
 Frog   179 KIMEKKYHNV--GLSKCEIKVALSKEQYQQQQQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 23/74 (31%)
RRM3_I_PABPs 202..282 CDD:240826 22/82 (27%)
hnrnpdNP_001025523.1 RRM1_hnRNPD 40..113 CDD:241200 24/82 (29%)
RRM2_hnRNPD 124..198 CDD:241027 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.