DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and CELF4

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001340669.1 Gene:CELF4 / 56853 HGNCID:14015 Length:545 Species:Homo sapiens


Alignment Length:262 Identity:68/262 - (25%)
Similarity:110/262 - (41%) Gaps:49/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 SLGSGHTSTSSHSANVGVGVGGGALASGSTGG---SGGNSSP------DSGKIYIKNLERSIDNK 127
            :|.:|....:|.|.|   |:|....::|...|   |.||.|.      |:.|::|..:.|::|.|
Human     7 TLANGQADNASLSTN---GLGSSPGSAGHMNGLSHSPGNPSTIPMKDHDAIKLFIGQIPRNLDEK 68

  Fly   128 AVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPR 191
            .:...|..||.|....|.||. .|..:|..|:.:...|:|..|          ...:|..|.:|.
Human    69 DLKPLFEEFGKIYELTVLKDRFTGMHKGCAFLTYCERESALKA----------QSALHEQKTLPG 123

  Fly   192 RDRE-----------------QEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEE 239
            .:|.                 ::..:..:.|:|..|:::.:|..:|.:||.:|.|....::...:
Human   124 MNRPIQVKPADSESRGGSSCLRQPPSQDRKLFVGMLNKQQSEDDVRRLFEAFGNIEECTILRGPD 188

  Fly   240 GRSRRFGFVAYENPQSALAAVIGLHGKQL--GDNKFLYVARALSKAERQQEINRKLEERKRQKAG 302
            |.|:...||.|.:...|.||:..|||.|.  |.:..|.|..|.:..||..       .|.:|.||
Human   189 GNSKGCAFVKYSSHAEAQAAINALHGSQTMPGASSSLVVKFADTDKERTM-------RRMQQMAG 246

  Fly   303 QI 304
            |:
Human   247 QM 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/70 (24%)
RRM3_I_PABPs 202..282 CDD:240826 25/81 (31%)
CELF4NP_001340669.1 Sufficient for RNA-binding and MSE-dependent splicing activity 1..298 68/262 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..39 6/23 (26%)
RRM1_CELF3_4_5_6 49..135 CDD:241076 23/95 (24%)
PABP-1234 <56..378 CDD:130689 53/210 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..149 2/27 (7%)
RRM2_CELF3_4_5_6 151..231 CDD:241079 24/79 (30%)
Necessary for TNNT2 exon 5 inclusion 239..258 5/10 (50%)
RRM_SF 417..>445 CDD:388407
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.