Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009304711.1 | Gene: | a1cf / 562916 | ZFINID: | ZDB-GENE-060824-3 | Length: | 550 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 48/207 - (23%) |
---|---|---|---|
Similarity: | 81/207 - (39%) | Gaps: | 40/207 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 GSGHTSTSSHSA------NVGVGV---GGGALASGSTGGSGGNSSPDSG-KIYIKNLERSIDNKA 128
Fly 129 VYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKV---------- 183
Fly 184 -HVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGF 247
Fly 248 VAYENPQSALAA 259 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 19/80 (24%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 12/58 (21%) | ||
a1cf | XP_009304711.1 | hnRNP-R-Q | 6..534 | CDD:273732 | 48/207 (23%) |
RRM_SF | 55..132 | CDD:302621 | 20/76 (26%) | ||
RRM_SF | 134..218 | CDD:302621 | 16/80 (20%) | ||
RRM3_ACF | 223..305 | CDD:240942 | |||
DND1_DSRM | 451..529 | CDD:291380 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |