DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and rbm4.2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_955971.1 Gene:rbm4.2 / 557528 ZFINID:ZDB-GENE-030131-3019 Length:385 Species:Danio rerio


Alignment Length:150 Identity:47/150 - (31%)
Similarity:69/150 - (46%) Gaps:21/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGMLC 178
            ||:|.||..:.....:...||.||.:..|:|.|:       |||||.||::.|.|||.|::....
Zfish     3 KIFIGNLSPTSTADDLRSLFSEFGIVKECDVLKN-------YGFVHMDSKKEAEAAIRKLHHYEL 60

  Fly   179 NNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSR 243
            ..|.::|       :..:.|......|:|.|:|...|.|.||..||.||.:....::.|      
Zfish    61 KGQAINV-------ELSKGKPRGSTKLHVSNISSGCTNQELRAKFEEYGPVVECDIVKD------ 112

  Fly   244 RFGFVAYENPQSALAAVIGL 263
             :.||..|....|:.|:.||
Zfish   113 -YAFVHMERMDDAMEAISGL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 24/69 (35%)
RRM3_I_PABPs 202..282 CDD:240826 19/61 (31%)
rbm4.2NP_955971.1 RRM1_2_CoAA_like 3..68 CDD:240789 26/78 (33%)
RRM_SF 78..144 CDD:302621 19/60 (32%)
ZnF_C2HC 161..177 CDD:197667
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.