DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and eif3g

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001016749.1 Gene:eif3g / 549503 XenbaseID:XB-GENE-6070198 Length:310 Species:Xenopus tropicalis


Alignment Length:162 Identity:38/162 - (23%)
Similarity:65/162 - (40%) Gaps:47/162 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 ILNCNVAKDEDGNSR----------------GYGFVHFDSEEA-------ARAAIEKVNGMLCNN 180
            |::|.:.|.:...:|                ..|....|.|:|       |:|.:.|..      
 Frog   143 IVSCRICKGDHWTTRCPYKDTLGPMQKELAEQLGLSTGDKEKAPGAEPEPAQAPVSKTG------ 201

  Fly   181 QKVHVVKFIP--------RRDREQE---KATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKL 234
                  |::|        ||....:   :|.....:.|.||||:..|..|:|:|.|:|.|:...|
 Frog   202 ------KYVPPSLRDGGSRRGESMQPNRRADDNA
TIRVTNLSEDTRETDLQELFRPFGSISRIYL 260

  Fly   235 MLDE-EGRSRRFGFVAYENPQSALAAVIGLHG 265
            ..|: .|:|:.|.|:::...:.|..|:.|:.|
 Frog   261 AKDKTTGQSKGFAFISFHRREDAARAIAGVSG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 11/68 (16%)
RRM3_I_PABPs 202..282 CDD:240826 22/65 (34%)
eif3gNP_001016749.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
eIF3g 45..164 CDD:372066 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..229 11/61 (18%)
RRM_eIF3G_like 230..306 CDD:240854 22/63 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.