DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Hnrnpdl

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_057899.2 Gene:Hnrnpdl / 50926 MGIID:1355299 Length:420 Species:Mus musculus


Alignment Length:336 Identity:82/336 - (24%)
Similarity:132/336 - (39%) Gaps:68/336 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SMTFRG----NPANYHQQQPALNHHTLAAAHHQQQLHHHAAAAGHLSHVGGGHAASNHLAAAAVL 65
            ::..||    .|....|..|.|.....:|:....:.......|...|.:.||        ||...
Mouse    21 TLASRGLSHWRPRAPRQLAPLLPSLASSASRQGARRSPRHVTAQQPSRLAGG--------AAIKG 77

  Fly    66 GRHGHNSLGSGHTSTSSHSANVGVGVGGGA-----LASGS---------------TGGSGGNSS- 109
            ||.....|...|..:||...:.....|...     ||.||               ..||..|:| 
Mouse    78 GRRRRPDLFRRHFKSSSIQRSAAAAAGTRTARQHPLADGSATMEDMNEYSNIEEFAEGSKINASK 142

  Fly   110 --PDSGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIE 171
              .|.||::|..|......|.:.:..|.||.:::|.:..|. .|.|||:|||.|....:....:|
Mouse   143 NQQDDGKMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLE 207

  Fly   172 ----KVNGMLCNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSH 232
                |::|.|.:          |:|.:..:.....|.::|..||.:.:|:.::|.|..:|.|.:.
Mouse   208 LKEHKLDGKLID----------PKRAKALKGKEPPKKVFVGGLSPDTSEEQIKEYFGAFGEIENI 262

  Fly   233 KLMLDEEGRSRR-FGFVAY--ENPQSALAAVIGLHGK--QLGDNKFLYVARALSKAERQQEINRK 292
            :|.:|.:...|| |.|:.|  |.|...|     |..:  |:|..|      ...|..:.:|:.| 
Mouse   263 ELPMDTKTNERRGFCFITYTDEEPVKKL-----LESRYHQIGSGK------CEIKVAQPKEVYR- 315

  Fly   293 LEERKRQKAGQ 303
             :::::||.|:
Mouse   316 -QQQQQQKGGR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/74 (27%)
RRM3_I_PABPs 202..282 CDD:240826 23/84 (27%)
HnrnpdlNP_057899.2 RRM1_hnRPDL 149..224 CDD:241202 23/84 (27%)
RRM2_hnRPDL 234..308 CDD:241029 23/84 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.