DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Hrb87F

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001163602.1 Gene:Hrb87F / 48535 FlyBaseID:FBgn0004237 Length:385 Species:Drosophila melanogaster


Alignment Length:203 Identity:53/203 - (26%)
Similarity:100/203 - (49%) Gaps:28/203 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 NSSPDSG----------KIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGYGFVHF 160
            |.:.|.|          |::|..|:....:..:...|..:|||::..|.|| :...|||:||:.:
  Fly     8 NGNYDDGEEITEPEQLRKLFIGGLDYRTTDDGLKAHFEKWGNIVDVVVMKDPKTKRSRGFGFITY 72

  Fly   161 DS----EEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKA-THFKNLYVKNLSEEFTEQHLR 220
            ..    :.|..|...|::|     :.|...:.:||::.:...| ...|.|:|..|.::..|:.||
  Fly    73 SQSYMIDNAQNARPHKIDG-----RTVEPKRAVPRQEIDSPNAGATVKKLFVGGLRDDHDEECLR 132

  Fly   221 EMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENPQSALAAVIGLHGKQLGDNKFLYVARALSKAE 284
            |.|:.:|:|.|..::.|:: |:.|.|.|:.::: ...:..:| |.......||.|.|.:|::|  
  Fly   133 EYFKDFGQIVSVNIVSDKDTGKKRGFAFIEFDD-YDPVDKII-LQKTHSIKNKTLDVKKAIAK-- 193

  Fly   285 RQQEINRK 292
              |:::|:
  Fly   194 --QDMDRQ 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 19/74 (26%)
RRM3_I_PABPs 202..282 CDD:240826 24/80 (30%)
Hrb87FNP_001163602.1 RRM1_hnRNPA_like 25..102 CDD:241022 20/81 (25%)
RRM_SF 116..188 CDD:302621 21/73 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.