Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138880.1 | Gene: | NONO / 4841 | HGNCID: | 7871 | Length: | 471 | Species: | Homo sapiens |
Alignment Length: | 232 | Identity: | 51/232 - (21%) |
---|---|---|---|
Similarity: | 96/232 - (41%) | Gaps: | 50/232 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 SGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVN-- 174
Fly 175 ---------------------------GMLCNNQKVHVVKFIPRR-----DREQEKATHFKNLY- 206
Fly 207 VKNLSEEFTEQHLREM-----FEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGK 266
Fly 267 QLGDNKFLYVARALSKAERQQEINRKLEE-RKRQKAG 302 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 21/98 (21%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 15/85 (18%) | ||
NONO | NP_001138880.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..51 | ||
DBHS | 54..373 | 51/232 (22%) | |||
RRM1_p54nrb | 73..143 | CDD:410001 | |||
RRM_SF | 149..228 | CDD:418427 | 19/78 (24%) | ||
NOPS_p54nrb_PSF_PSPC1 | 219..311 | CDD:240581 | 13/91 (14%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 443..471 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |