DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and NONO

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001138880.1 Gene:NONO / 4841 HGNCID:7871 Length:471 Species:Homo sapiens


Alignment Length:232 Identity:51/232 - (21%)
Similarity:96/232 - (41%) Gaps:50/232 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 SGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVN-- 174
            |..:.::||.:.:.|:.:.:.|||||.:....|..|:.|...|.|.|.|..:.|||.|:::.:  
Human   147 SASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEG 211

  Fly   175 ---------------------------GMLCNNQKVHVVKFIPRR-----DREQEKATHFKNLY- 206
                                       .::..||:.|..:..|.|     ..|.|.|..:|.|. 
Human   212 SFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIE 276

  Fly   207 VKNLSEEFTEQHLREM-----FEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGK 266
            ::...::..:::::|.     .|.......|::||..:...||         |..|..:..||.:
Human   277 MEKQQQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRR---------QEELRRMEELHNQ 332

  Fly   267 QLGDNKFLYVARALSKAERQQEINRKLEE-RKRQKAG 302
            ::...|.|.:.:...:..|::|:.|:.|| .:||:.|
Human   333 EVQKRKQLELRQEEERRRREEEMRRQQEEMMRRQQEG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 21/98 (21%)
RRM3_I_PABPs 202..282 CDD:240826 15/85 (18%)
NONONP_001138880.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51
DBHS 54..373 51/232 (22%)
RRM1_p54nrb 73..143 CDD:410001
RRM_SF 149..228 CDD:418427 19/78 (24%)
NOPS_p54nrb_PSF_PSPC1 219..311 CDD:240581 13/91 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..471
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.