DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and spen

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_722615.1 Gene:spen / 44205 FlyBaseID:FBgn0016977 Length:5560 Species:Drosophila melanogaster


Alignment Length:306 Identity:69/306 - (22%)
Similarity:118/306 - (38%) Gaps:69/306 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HTLAAAHHQQQLHHHAAAAGHLSH------VGGGHA------ASNHLAAAAVLGRHGHNSLGSGH 77
            |.:...|:   ||..:..:...||      ....|:      :|:|..|::.:...|:.::..|.
  Fly   428 HPIRTRHN---LHGRSTTSSSRSHSRSPSSYSSSHSSSSSSHSSSHSHASSPVQSSGNCAMAEGR 489

  Fly    78 ----------TSTSSHSANVGV-----GVGGGALASGSTGGSGGNS------------SPDSG-- 113
                      ||.||:.:...|     |||||..:|.|:..|..:|            |.|:.  
  Fly   490 SSRTVNSVTVTSNSSNPSGTAVTVSSAGVGGGCGSSSSSSSSSSSSGSSCLTANPVVHSEDNRPL 554

  Fly   114 KIYIKNL-ERSIDNK---AVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIE--- 171
            .|.::|| .||.|..   .::..:...|.:....|...   ||..|..|.|...:....|:|   
  Fly   555 AIRVRNLPARSSDTSLKDGLFHEYKKHGKVTWVKVVGQ---NSERYALVCFKKPDDVEKALEVSH 616

  Fly   172 -------KVNGMLCNNQKVHVVKFIP---RRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPY 226
                   |:.........|...:|.|   ..|....|:|  :.|::.||.::.|...||..||.:
  Fly   617 DKHFFGCKIEVEPYQGYDVEDNEFRPYEAELDEYHPKST--RTLFIGNLEKDITAGELRSHFEAF 679

  Fly   227 GRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDNK 272
            |.|.  ::.:.::|.: .:.|..|.:..|.:.|:..:.|:.||.|:
  Fly   680 GEII--EIDIKKQGLN-AYAFCQYSDIVSVVKAMRKMDGEHLGSNR 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 17/83 (20%)
RRM3_I_PABPs 202..282 CDD:240826 19/71 (27%)
spenNP_722615.1 RRM2_SHARP 555..628 CDD:240795 16/75 (21%)
RRM3_SHARP 654..726 CDD:240796 20/74 (27%)
RRM4_SHARP 727..803 CDD:240797
RILP-like 1997..>2055 CDD:304877
SPOC 5404..5527 CDD:285043
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.