DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and mod

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001247401.1 Gene:mod / 43764 FlyBaseID:FBgn0002780 Length:542 Species:Drosophila melanogaster


Alignment Length:142 Identity:35/142 - (24%)
Similarity:64/142 - (45%) Gaps:24/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYIKNL--ERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGML 177
            :.::|:  ..|..:.|:...|..||::...:|.    .:.....||.|...:||..|:.:::|..
  Fly   342 LVVENVGKHESYSSDALEKIFKKFGDVEEIDVV----CSKAVLAFVTFKQSDAATKALAQLDGKT 402

  Fly   178 CNNQKVHVVKFIPRRDREQEKATHFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLML------ 236
            .|..:..:.:|        |::|..:.:.|.||:.:.||..||::|...|.|.| .:||      
  Fly   403 VNKFEWKLHRF--------ERSTSGRAILVTNLTSDATEADLRKVFNDSGEIES-IIMLGQKAVV 458

  Fly   237 ---DEEGRSRRF 245
               |:||..:.|
  Fly   459 KFKDDEGFCKSF 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 15/71 (21%)
RRM3_I_PABPs 202..282 CDD:240826 17/53 (32%)
modNP_001247401.1 RRM_SF 177..244 CDD:302621
RRM_SF 260..327 CDD:240668
RRM_SF 342..411 CDD:240668 15/72 (21%)
RRM_SF 422..>465 CDD:302621 14/43 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.