Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651755.2 | Gene: | CG7903 / 43554 | FlyBaseID: | FBgn0039730 | Length: | 384 | Species: | Drosophila melanogaster |
Alignment Length: | 197 | Identity: | 40/197 - (20%) |
---|---|---|---|
Similarity: | 72/197 - (36%) | Gaps: | 50/197 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 SGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGM 176
Fly 177 LCNNQKVHV----VKFIP---------------RR----------DREQEKATHFKNLYVKNLSE 212
Fly 213 EFTEQHLRE------MFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDN 271
Fly 272 KF 273 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 16/69 (23%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 15/78 (19%) | ||
CG7903 | NP_651755.2 | RRM | <4..168 | CDD:223796 | 34/176 (19%) |
RRM_SF | 6..70 | CDD:302621 | 17/71 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45439619 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |