DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Hrb98DE

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_524543.1 Gene:Hrb98DE / 43385 FlyBaseID:FBgn0001215 Length:365 Species:Drosophila melanogaster


Alignment Length:208 Identity:55/208 - (26%)
Similarity:100/208 - (48%) Gaps:29/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SGSTGGSGGNSSPDS-------GKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRG 154
            :|::.|...:...||       .|::|..|:....::.:...|..:|||::..|.|| ....|||
  Fly     9 NGNSNGHDDDFPQDSITEPEHMRKLFIGGLDYRTTDENLKAHFEKWGNIVDVVVMKDPRTKRSRG 73

  Fly   155 YGFVHFDS----EEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKA-THFKNLYVKNLSEEF 214
            :||:.:..    :||.::...|::|.:     |...:.:||:|.:...| ...|.|:|..|.::.
  Fly    74 FGFITYSHSSMIDEAQKSRPHKIDGRV-----VEPKRAVPRQDIDSPNAGATVKKLFVGALKDDH 133

  Fly   215 TEQHLREMFEPYGRITSHKLMLDEE-GRSRRFGFVAYENPQSALAAVI----GLHGKQLGDNKFL 274
            .||.:|:.|:.:|.|....:::|:| |:.|.|.||.:::.......|:    .|:||.:.     
  Fly   134 DEQSIRDYFQHFGNIVDINIVIDKETGKKRGFAFVEFDDYDPVDKVVLQKQHQLNGKMVD----- 193

  Fly   275 YVARALSKAERQQ 287
             |.:||.|...||
  Fly   194 -VKKALPKQNDQQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 19/74 (26%)
RRM3_I_PABPs 202..282 CDD:240826 24/84 (29%)
Hrb98DENP_524543.1 RRM1_hnRNPA_like 32..109 CDD:241022 20/81 (25%)
RRM_SF 123..195 CDD:302621 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.