DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and trv

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:224 Identity:54/224 - (24%)
Similarity:93/224 - (41%) Gaps:50/224 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GGNSSPDSGK-------------IYIKNLERSIDNKAVYDTFSVFGNILNCNVAKD-EDGNSRGY 155
            ||....||.:             |::.:|...|:.:.:.:.|:.||.|.:|.|.:| :...|:||
  Fly   291 GGQDMEDSDEEMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGY 355

  Fly   156 GFVHFDSEEAARAAIEKVNGMLCNNQKVHV--VKFIPRRDREQEKATHFKNLY------------ 206
            |||.|..:..|.:||..:||....::.:..  ....|...:|..|...|..:|            
  Fly   356 GFVSFIKKSEAESAITAMNGQWLGSRSIRTNWATRKPPASKENIKPLTFDEVYNQSSPSNCTVYV 420

  Fly   207 --VKNLSEEFTEQHLREMFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLH----- 264
              |.:.....:|:.|::.|.|||.|...::..|     :.:.||.:...::|..|::|:|     
  Fly   421 GGVNSALTALSEEVLQKTFAPYGAIQEIRVFKD-----KGYAFVRFSTKEAATHAIVGVHNTEIN 480

  Fly   265 --------GKQLGD--NKFLYVARALSKA 283
                    ||:.||  |......:||:.|
  Fly   481 AQPVKCSWGKESGDPNNAQTIATQALNSA 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 22/70 (31%)
RRM3_I_PABPs 202..282 CDD:240826 24/108 (22%)
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 22/73 (30%)
RRM3_TIA1_like 416..491 CDD:240800 16/79 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.