DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and elavl2

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001002172.2 Gene:elavl2 / 431719 ZFINID:ZDB-GENE-040704-9 Length:389 Species:Danio rerio


Alignment Length:199 Identity:55/199 - (27%)
Similarity:98/199 - (49%) Gaps:17/199 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LGSGHTSTSSHSANVGVGVGGGALASGSTGG-SGGNSSPDSGKIYIKN-LERSIDNKAVYDTFSV 135
            |.:|.:.|||:..|        ::::..|.. ...|.|.||....|.| |.:::..:.:...|..
Zfish    34 LSNGPSCTSSNGPN--------SVSNTCTSPVEMPNGSEDSKTNLIVNYLPQNMTQEELKSLFGS 90

  Fly   136 FGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKA 199
            .|.|.:|.:.:|: .|.|.|||||::...:.|..||..:||:....:.:.|     ...|....:
Zfish    91 IGEIESCKLVRDKITGQSLGYGFVNYMEPKDAEKAINTLNGLRLQTKTIKV-----SYARPSSAS 150

  Fly   200 THFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAVIGL 263
            ....||||..|.:..|::.|.::|..:|||.:.::::|: .|.||..||:.::....|..|:.||
Zfish   151 IRDANLYVSGLPKTMTQKELEQLFSQFGRIITSRILVDQVTGVSRGVGFIRFDRRVEAEEAIKGL 215

  Fly   264 HGKQ 267
            :|::
Zfish   216 NGQK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 20/71 (28%)
RRM3_I_PABPs 202..282 CDD:240826 22/67 (33%)
elavl2NP_001002172.2 ELAV_HUD_SF 65..388 CDD:273741 46/160 (29%)
RRM1_Hu 67..144 CDD:241094 21/81 (26%)
RRM2_HuB 149..238 CDD:241219 22/71 (31%)
RRM_SF 303..388 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.