Sequence 1: | NP_001246493.1 | Gene: | CG4612 / 37914 | FlyBaseID: | FBgn0035016 | Length: | 307 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002172.2 | Gene: | elavl2 / 431719 | ZFINID: | ZDB-GENE-040704-9 | Length: | 389 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 55/199 - (27%) |
---|---|---|---|
Similarity: | 98/199 - (49%) | Gaps: | 17/199 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 LGSGHTSTSSHSANVGVGVGGGALASGSTGG-SGGNSSPDSGKIYIKN-LERSIDNKAVYDTFSV 135
Fly 136 FGNILNCNVAKDE-DGNSRGYGFVHFDSEEAARAAIEKVNGMLCNNQKVHVVKFIPRRDREQEKA 199
Fly 200 THFKNLYVKNLSEEFTEQHLREMFEPYGRITSHKLMLDE-EGRSRRFGFVAYENPQSALAAVIGL 263
Fly 264 HGKQ 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4612 | NP_001246493.1 | RRM2_I_PABPs | 115..185 | CDD:240825 | 20/71 (28%) |
RRM3_I_PABPs | 202..282 | CDD:240826 | 22/67 (33%) | ||
elavl2 | NP_001002172.2 | ELAV_HUD_SF | 65..388 | CDD:273741 | 46/160 (29%) |
RRM1_Hu | 67..144 | CDD:241094 | 21/81 (26%) | ||
RRM2_HuB | 149..238 | CDD:241219 | 22/71 (31%) | ||
RRM_SF | 303..388 | CDD:302621 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |