DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4612 and Syp

DIOPT Version :9

Sequence 1:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster
Sequence 2:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster


Alignment Length:207 Identity:54/207 - (26%)
Similarity:110/207 - (53%) Gaps:25/207 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GGNSSPDSGKIYIKNLERSIDNKAVYDTFS-----VFGNILNCNVAKDEDGNSRGYGFVHFDSEE 164
            |...|.::.::::.|:.::.|...:.:.||     ::..|:..  :.|:...:||:.|:.::|.:
  Fly   279 GVTISFNNHRLFVGNIPKNRDRDELIEEFSKHAPGLYEVIIYS--SPDDKKKNRGFCFLEYESHK 341

  Fly   165 AARAAIEKV-NGMLCNNQKVHVVKFI-----PRRDREQEKATHFKNLYVKNLSEEFTEQHLREMF 223
            ||..|..:: .|.:    ||.....|     |:.:.:::..:..|.|||:||:::.:|..|:|.|
  Fly   342 AASLAKRRLGTGRI----KVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVSEDKLKEQF 402

  Fly   224 EPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLG-DNKFLYVARALSKAERQQ 287
            |.||::...|.:.|       :.|:.:|:..||:.|:.||:||::| .|..:.:|:..|..::::
  Fly   403 EQYGKVERVKKIKD-------YAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAKPPSDKKKKE 460

  Fly   288 EINRKLEERKRQ 299
            ||.|..|.|..|
  Fly   461 EILRARERRMMQ 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 16/75 (21%)
RRM3_I_PABPs 202..282 CDD:240826 27/80 (34%)
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 1/3 (33%)
RRM2_hnRNPR_like 286..367 CDD:240696 17/86 (20%)
RRM3_hnRNPR_like 381..452 CDD:240697 27/77 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.